PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4NG128900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRF
Protein Properties Length: 318aa    MW: 33691.6 Da    PI: 9.0527
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4NG128900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.92e-2485128144
                  WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                          d+epgrCrRtDGKkWRCsr++ +++k+CE+H+hrg+srsrk++e
  Pavir.4NG128900.1.p  85 DPEPGRCRRTDGKKWRCSREAHGDSKYCEKHIHRGKSRSRKPVE 128
                          79***************************************998 PP

2QLQ613.2e-211246236
                  QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                          FTa+Q+q+L++Q+l+yKy+a+++PvP++L+++++
  Pavir.4NG128900.1.p 12 LFTASQWQELEHQALIYKYMASGAPVPHDLVLPLR 46
                         5*******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.8E-91147IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.1431247IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.0E-151345IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.7585129IPR014977WRC domain
PfamPF088791.1E-1986128IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MMLSGHGGGR RLFTASQWQE LEHQALIYKY MASGAPVPHD LVLPLRLATG VDTAPSLAFP  60
PQTSPSLGYW GCYGAGAPFG RKAEDPEPGR CRRTDGKKWR CSREAHGDSK YCEKHIHRGK  120
SRSRKPVEAV ASSATAGYRP SALSISPPRA PDAAPGFGHH QQQPHHGASS ARAPAHQAAA  180
GAPLQLHLDA SLHAASPPPS YHRYAHAHYA PPPPFPGGYG HAQAKELQDA ELRRRHYLAL  240
GADLSLDKPP AAAAGGQDAA AGAEKPLRLF FDEWPREGGD ARPWTVGAED ATQLSISIPA  300
ASPSDLAAAA ARYHNGE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.73792e-47callus| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0400710.0BT040071.1 Zea mays full-length cDNA clone ZM_BFc0063G19 mRNA, complete cds.
GenBankBT0415400.0BT041540.1 Zea mays full-length cDNA clone ZM_BFc0173L15 mRNA, complete cds.
GenBankBT0553900.0BT055390.1 Zea mays full-length cDNA clone ZM_BFb0108H20 mRNA, complete cds.
GenBankEF5158500.0EF515850.1 Zea mays putative growth-regulating factor 11 (GRF11) mRNA, complete cds.
GenBankJX4699850.0JX469985.1 Zea mays subsp. mays clone UT3345 GRF-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964938.11e-161PREDICTED: growth-regulating factor 2-like isoform X1
RefseqXP_004964939.11e-161PREDICTED: growth-regulating factor 2-like isoform X2
SwissprotQ6AWY71e-97GRF2_ORYSJ; Growth-regulating factor 2
TrEMBLK3XYB41e-161K3XYB4_SETIT; Uncharacterized protein
STRINGSi006922m1e-161(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139922527
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-42growth-regulating factor 5